95
|
Chem Impex International
di tert butyl dicarbonate Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/di tert butyl dicarbonate/product/Chem Impex International Average 95 stars, based on 1 article reviews
di tert butyl dicarbonate - by Bioz Stars,
2026-06
95/100 stars
|
Buy from Supplier |
95
|
Chem Impex International
solution di tert butyl dicarbonate Solution Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/solution di tert butyl dicarbonate/product/Chem Impex International Average 95 stars, based on 1 article reviews
solution di tert butyl dicarbonate - by Bioz Stars,
2026-06
95/100 stars
|
Buy from Supplier |
93
|
Boster Bio
rabbit anti ccr8 Rabbit Anti Ccr8, supplied by Boster Bio, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/rabbit anti ccr8/product/Boster Bio Average 93 stars, based on 1 article reviews
rabbit anti ccr8 - by Bioz Stars,
2026-06
93/100 stars
|
Buy from Supplier |
90
|
ProteoGenix
tamra -c-ter bdnf Tamra C Ter Bdnf, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tamra -c-ter bdnf/product/ProteoGenix Average 90 stars, based on 1 article reviews
tamra -c-ter bdnf - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
Verlag GmbH
ter ms and c onditions Ter Ms And C Onditions, supplied by Verlag GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ter ms and c onditions/product/Verlag GmbH Average 90 stars, based on 1 article reviews
ter ms and c onditions - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
ProteoGenix
n-terminal 5-tamra (5-carboxytetramethylrhodamine) label N Terminal 5 Tamra (5 Carboxytetramethylrhodamine) Label, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/n-terminal 5-tamra (5-carboxytetramethylrhodamine) label/product/ProteoGenix Average 90 stars, based on 1 article reviews
n-terminal 5-tamra (5-carboxytetramethylrhodamine) label - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
DuPont de Nemours
antiserum anti-c-myc n-ter ii Antiserum Anti C Myc N Ter Ii, supplied by DuPont de Nemours, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/antiserum anti-c-myc n-ter ii/product/DuPont de Nemours Average 90 stars, based on 1 article reviews
antiserum anti-c-myc n-ter ii - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
peptide nsp (n ter - dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf-c ter) Peptide Nsp (N Ter Dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf C Ter), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/peptide nsp (n ter - dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf-c ter)/product/GenScript corporation Average 90 stars, based on 1 article reviews
peptide nsp (n ter - dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf-c ter) - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
Informa UK Limited
in ter fa c e 2022 In Ter Fa C E 2022, supplied by Informa UK Limited, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/in ter fa c e 2022/product/Informa UK Limited Average 90 stars, based on 1 article reviews
in ter fa c e 2022 - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
CST Berger
ter ms and c onditions Ter Ms And C Onditions, supplied by CST Berger, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/ter ms and c onditions/product/CST Berger Average 90 stars, based on 1 article reviews
ter ms and c onditions - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
Auspep Pty
human c-ter anking peptide of gastrin (ctfp) Human C Ter Anking Peptide Of Gastrin (Ctfp), supplied by Auspep Pty, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/human c-ter anking peptide of gastrin (ctfp)/product/Auspep Pty Average 90 stars, based on 1 article reviews
human c-ter anking peptide of gastrin (ctfp) - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
90
|
GeneTex
anti-myosin 18b c-ter gtx104872 Anti Myosin 18b C Ter Gtx104872, supplied by GeneTex, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/anti-myosin 18b c-ter gtx104872/product/GeneTex Average 90 stars, based on 1 article reviews
anti-myosin 18b c-ter gtx104872 - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |